Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) (Halobacterium pharaonis)

Taxonomy: cellular organisms; Archaea; Euryarchaeota; Halobacteria; Halobacteriales; Halobacteriaceae; Natronomonas; Natronomonas pharaonis

Average proteome isoelectric point is 4.71

Get precalculated fractions of proteins

Acidic
pI < 6.8
6.8-7.4
pI > 7.4
Basic
    
All


Virtual 2D-PAGE plot for 2,765 proteins (isoelectric point calculated using IPC_method)

Get csv file with sequences according given criteria:
        -     Method 

     -  kDa    
                                                                                      

* You can choose from 18 different methods for calculating isoelectric point

Protein with the lowest isoelectric point:
>tr|Q3IQ19|Q3IQ19_NATPD Probable cell surface glycoprotein
MLASAVAFAAVPAAAASDGESEPQESPSAPVSDFADYMVVPETTEGESGDRVEIDVTAETLIGDNEDADVTGYELDIEYDDDKLVFADADTFLTEPEELEIDDDGDSVQVEWVPSFLDVVADEFIAEVADGEASPNMNVTLATLEFAVTGDPGETADIDITDDSTMWWGSTGISEYDDDNVWWGTSEVEI
VDELDDDGPEDPDGPQVGEFTAVSQGNYIAFNEDESDREDEGVQFPVQEDGDTPIQIEGEIFDDGTWQSTDATFPTLDAPAGLEADVEVIDNLYGDIDIEGDEMTAEGDLNVIVDGNEDDSFEFEIGATTGESGILDGDASLGDDGGSVTLVDNEFLVEDTTGDDIVDSGLGLPSTQEGDNWLSLALDIE
VVDTEVPTGTVEGTVESEDGAPIEGADVNVVDELDATQTGEDGAFEFELEAGTQELDVTAEGYVNKTAEVTVEEDETTERTLTLESGDAYFEAVAVVGDDVEAGEEAEILGTVENTGEGAGEQDVTLSVADEEVTETLEVGFEEETTIDLSWETDADDDGEYTAELDTGDATAEAEVTVSEADDNETDSG
DDVLTATSQGGFIAFTEDTSSETTASDEGLSLPDEDDGDTPIELEADYNPDDNSWESTAVDFPNLDLGEAGIDGVEAEIDTPNGLEGTIDTDDNTMTVEGTLAVTAADGNFEFDIDATTDGSNDLDGDADLDADGGTITAVDNEYLIQEESGYDIMDNALDLPATTPGENWLTLSFDIDIEETAADTGDI
EGTVESSTGDPIEDATVDIEDELDDTTTDDDGDFELDDIETGDYTLEITADGHADTTTDVTVDEDDTTTVDVELDADDPEMTVDVDVTDAEPGDTVALTATVENTGGAPGSEEVTATVGDETKTQTVEVAPGDTETVTLEWDVAEEDLGEHTAEIEGESFESTADVTVAEDLGPDVDADGDTFVATSQGG
FISFAEDGDKETAIEEGLEFPSADAGEEPIEIVGAVDDDGSWESSSIRFPDLVTDSGIAAEVSAPDGLSGEIDADSGEMSANGELSVAIEGDDDTQFSFEIATTVGESESLSGEASLDEEGGTATLVDNEFTVPDETGDPLIDGTLDLPATDEGTNWFELDLEVELDADDDATSQQQQQNNEDESDEDGG
EATPESNGGLVTSFGQLTGFLGLLTAGGIVTFSLATRLAEILDV
Molecular weight: 124.38 kDa
Isoelectric point according different methods:






Protein with the highest isoelectric point:
>tr|Q3INL3|Q3INL3_NATPD Uncharacterized protein
MVLSTYAAVRTLHVLAVSLLVGGSAVLWLGLRVGTARLPVRLLSWFEAVFWGGLGIVVFTGLGNLVAFGIPPVDSHRGIVLTAKFVAVLGLAVFALVRAAAVIELQRAGNGAVGGRRLRLLYAATAWLSTAAVLLAGVLARG
Molecular weight: 14.71 kDa
Isoelectric point according different methods:






General Statistics

Number of major isoforms

Number of additional isoforms

Number of all proteins

Number of amino acids

Min. Seq. Length

Max. Seq. Length

Avg. Seq. Length

Avg. Mol. Weight

2,763

2

2,765

810,724

29

1,999

293.4

31.8 kDa

Amino acid frequency

Ala

Cys

Asp

Glu

Phe

Gly

His

Ile

Lys

Leu

Met

Asn

Gln

Pro

Arg

Ser

Thr

Val

Trp

Tyr

11.41

0.77

8.76

8.85

3.25

8.41

1.97

4.2

1.89

8.77

1.73

2.21

2.58

4.6

6.37

5.26

6.38

8.89

1.05

2.64

Note: For statistics only major isoforms were used (in this case 2,763 proteins)
For dipeptide frequency statistics click here
See this proteome in: uniprot_link
Proteome-pI is available under Creative Commons Attribution-NoDerivs license, for more details see here

Reference: Kozlowski LP. Proteome-pI: proteome isoelectric point database. Nucleic Acids Res. 2016. doi: 10.1093/nar/gkw978       Contact: Lukasz P. Kozlowski