Virtual 2D-PAGE plot for 8,049 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|G0QNS0|G0QNS0_ICHMG Putative uncharacterized protein
MDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDIDKTIQQNQNQKY
Molecular weight: 15.11 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|G0QSK8|G0QSK8_ICHMG Putative uncharacterized protein
MKLFKKIIKQQRMYLIKVNNKHIKIKDKLKIQINKNKFYKINKNKKQSKTRLRIRIRIRIRIRIRLRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRIRLRIRIRIRIRIRIRLRRRIRIRIKIRIRIRIRIRIRIKIRIRIRIRI RIRIKIRIRIRIKQKLKLKLK
Molecular weight: 27.76 kDa Isoelectric point according different methods: