Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)
Average proteome isoelectric point is 6.67
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 1,852 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q9WYU7|Q9WYU7_THEMA Uncharacterized protein
MKKLLALFLVLGLLVTAAFAYEDVVKVNVSGTGYFNAYLDEEGIDLEGGISDLSVSISPSSGSVTAPATITAEFSIDVLGTDASLSKIAVTTDLFDLTYYNSDIYGDGYVFYYVGDRALEFTPKLGLEGISLTAYFADIVSETDLTNATNDTNNYFDDAVALKLGVTNLDLLDATLFGAFYDTDTNNATS
AYGYAAHLNLTGKDILENLVVDLAYAYEATSMYLVEAQYSKSFEMEPVTLTVSPYFVYSEGAPTYYDDDSVDGDGWTAPWGSKLVKVGLKAEAGVTDEVTFSAELTPTYDLDANSFSLPVTLALAYDSDMAEANVSASWDDAVASATNVTIDANLTVTAVENLTVKAAAQYKVATNELGYNVDTSYVYGP
LTTGFFFGTLFDSNSDGTADINDYFTWYLYLKASVAF
Molecular weight: 44.87 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P58288|RL34_THEMA 50S ribosomal protein L34
MKRTYQPSRRKRKRTHGFLARKRTPGGRRVLKNRRRKGRWRLTV
Molecular weight: 5.5 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
1,851 |
1 |
1,852 |
582,713 |
30 |
1,690 |
314.8 |
35.7 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.85 |
0.71 |
4.96 |
8.92 |
5.19 |
6.91 |
1.59 |
7.18 |
7.62 |
10.04 |
2.4 |
3.61 |
2.01 |
3.99 |
5.54 |
5.65 |
4.53 |
8.61 |
1.1 |
3.58 |
Note: For statistics only major isoforms were used (in this case 1,851 proteins)
For dipeptide frequency statistics click
here