Virtual 2D-PAGE plot for 48 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|Q6ZYJ2|Q6ZYJ2_PSVY Putative uncharacterized protein
MSAFDEFNEGFGLDVSDTPEELAFETESAIEEIESETSPGDQPKGSEPEEIRVWAEEKARKAVEEGREVTNWADWIMGWRTPNASEKKMEFMYWYTRTYLEEAKDIRPDIADALARGMAGLAFGRTDWVASMLDPQIMRHIYTDPEVARIYSETRDMLRRVSDYYISLTTMELGKVADIIAEAKAKGENP EVVAREIAEAVPRLSPKSLYFNLYYIGRSIGDNYVLEVARVLSKMRRR
Molecular weight: 27.32 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|Q6ZYI9|Q6ZYI9_PSVY Putative uncharacterized protein
MTARNPFRKYRNKYLDKFLITVAIELALFSYIIAVYVYKLPLIFSRWALPLIISTILAGFVLLYLVFASMFYIFQTLYFWRLERLYERNPRLAVRYFAKDYLSEEAKLARKALSLVGLS
Molecular weight: 14.18 kDa Isoelectric point according different methods: