Musca hytrovirus(isolate Musca domestica/United States/Boucias/-) (MHV)
Average proteome isoelectric point is 6.87
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 108 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B2YG25|B2YG25_MHVB Putative uncharacterized protein
MSRNFAFFLFLGICLVASRVVDCQEGTEDQTVNETQGDQSVNENPGDQSVDEAQGDQSVNENPGDQSVYEAQGDQSVNEVPEDQPADDVADPVPDDQPADDVGSESTNSPHEITEPDASGDGQASEDQSAPTEAPGDQSAPTEAPGDQPVDEAPGASENEKKEEEEEPAVVPDGDGSGDVNNDSNHSNST
EVAVEDNSDHVDDQSENNPGGRDEVPTESPPEDTSAPENIEDEKSKYLGDEYNFFMEHCSPSESVNHFGYELLYDFFINVLHIFYSDHALDGYNSNRTIQKYFGRDVYDQVFNDYANAHSLSEPLMSCPENVEEKFKKSINEFIVHALSTLLTIYYYGTVSADDIQRIEETLSAGQQIDSLIDGYGQMSG
VLMDLCRKCH
Molecular weight: 42.67 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B2YG03|B2YG03_MHVB Putative uncharacterized protein
MAKASLDSISRNMRRRKRKSSSSSSSSSSSSSKRRTPRRKSSSKRRTTTRRRRRAPAYRR
Molecular weight: 7.02 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
108 |
0 |
108 |
37,570 |
51 |
1,780 |
347.9 |
40.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
4.96 |
2.04 |
6.42 |
5.19 |
4.85 |
4.36 |
2.31 |
6.94 |
4.88 |
9.08 |
3.05 |
6.54 |
3.7 |
4.06 |
6.11 |
7.49 |
6.27 |
6.22 |
0.73 |
4.79 |
Note: For statistics only major isoforms were used (in this case 108 proteins)
For dipeptide frequency statistics click
here