Human papillomavirus type 1a
Average proteome isoelectric point is 6.04
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 8 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>sp|P06465|VE7_HPV1A Protein E7
MVGEMPALKDLVLQLEPSVLDLDLYCYEEVPPDDIEEELVSPQQPYAVVASCAYCEKLVRLTVLADHSAIRQLEELLLRSLNIVCPLCTLQRQ
Molecular weight: 10.5 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P03118|VE2_HPV1A Regulatory protein E2
MENLSSRLDLLQEQLMNLYEQDSKLIEDQIKQWNLIRQEQVLFHFARKNGVMRIGLQAVPSLASSQEKAKTAIEMVLHLESLKDSPYGTEDWSLQDTSRELFLAPPAGTFKKSGSTLEVTYDNNPDNQTRHTIWNHVYYQNGDDVWRKVSSGVDAVGVYYLEHDGYKNYYVLFAEEASKYSTTGQYAVNY
RGKRFTNVMSSTSSPRAAGAPAVHSDYPTLSESDTAQQSTSIDYTELPGQGETSQVRQRQQKTPVRRRPYGRRRSRSPRGGGRREGESTPSRTPGSVPSARDVGSIHTTPQKGHSSRLRRLLQEAWDPPVVCVKGGANQLKCLRYRLKASTQVDFDSISTTWHWTDRKNTERIGSARMLVKFIDEAQREK
FLERVALPRSVSVFLGQFNGS
Molecular weight: 45.48 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8 |
0 |
8 |
2,408 |
63 |
612 |
301.0 |
34.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.69 |
2.03 |
5.77 |
6.81 |
4.15 |
5.4 |
1.62 |
5.07 |
4.32 |
9.97 |
1.74 |
4.19 |
5.11 |
5.61 |
6.56 |
8.43 |
6.6 |
6.27 |
1.29 |
3.36 |
Note: For statistics only major isoforms were used (in this case 8 proteins)
For dipeptide frequency statistics click
here