Postia placenta (strain ATCC 44394 / Madison 698-R) (Brown rot fungus) (Poria monticola)
Average proteome isoelectric point is 6.67
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 8,983 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|B8PIJ3|B8PIJ3_POSPM Predicted protein (Fragment)
LIDNDSGLLWTGSIEIGTPPQSFIVCFDTGSADLWVASSQCNGCDAQDTYDASSSSTSQEQQGTFQISYEGGQDVTGPIYTDTVSVAGVNVTGQYFSPVTQASDMSNEFPLDGILGMGWPQLSNLQQDPYFFSAISQNAVQQGVFGFYLAANNSELYLGGTDSTLYTGSIEYHALASDSEGWWQIANASF
LVNGQSAASGFETIIDSGSTFMYAPVEAAAQVYGTIEGAQQTEEGFYMFPCSSAPTVAFSWGGNNWEIPADSFNLGEVEEDYCLGALISADMGTNAWTVGDVFLTNVYSAFSVNQSAVGFA
Molecular weight: 33.04 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|B8PK20|B8PK20_POSPM Predicted protein (Fragment)
PFSLLKLTTTSPILSVVQQVRFRSRGTEYQPSQRKRKRKHGFLARKRSVSGQKILVRRRAKGRRFLSH
Molecular weight: 8.02 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
8,983 |
0 |
8,983 |
3,900,308 |
27 |
3,369 |
434.2 |
48.0 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
9.46 |
1.49 |
5.78 |
5.94 |
3.3 |
6.38 |
2.72 |
4.53 |
3.99 |
9.07 |
2.1 |
3.04 |
3.7 |
6.58 |
7.03 |
8.3 |
6.06 |
6.45 |
1.53 |
2.56 |
Note: For statistics only major isoforms were used (in this case 8,983 proteins)
For dipeptide frequency statistics click
here