Virtual 2D-PAGE plot for 13,062 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|M2YX96|M2YX96_PSEFD Uncharacterized protein (Fragment)
VSYTDAVSYTDAVSYTDAVSYTDAASYTDAASYTDAASYTDAASYTDAASYTDTASFCFCL
Molecular weight: 6.41 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|M3AF09|M3AF09_PSEFD Uncharacterized protein
MVLLLLLLIQRLLQRLLQRLLQLQIPVVQVLVVLVLLLLLLIQRLLQLQILVVQALVVQVLLLLLLIQRLLQLQILVAQALMAQALVVQALVVQALVVQVLVVQALVVQALVVQALVVQALVVQVLVVQALVVQALVVRAPVVRAPVVRAPVVQALVVQALVVQALVVQALVVQALVVQALVVQAPVVRA LVVQALVVQALQIPKHLHQQSQLPNRKIPKHLHRLRRWAPPLMIMLRFTA
Molecular weight: 26.45 kDa Isoelectric point according different methods: