Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Average proteome isoelectric point is 6.98
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 3,085 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q9RT32|Q9RT32_DEIRA Uncharacterized protein
MTGPYDRPTSPASEPTDTPAPMPERLPGGTDTGPVMDPPTNPDTPGMPEPQPTSNPDLPGMPEPMPAM
Molecular weight: 7.07 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|Q9RYP2|Q9RYP2_DEIRA Adenine deaminase-related protein
MAHHLGATAACAGAAAVFSGRARAADELGNRCRHRPALRGDDSARLAGHAHHTHFGAAGRTGTGRPAAGPAGGQSGAGEPRRVAHPALYSGGRADRAGRAGSAAGARYREILGPARPRGDRPWVSRRLRAAARLATLRGAGNLRGRRGSAARRRDAPPARWRRRPRARLGRGHLRSARALAHAPDVSRPD
RHRACGAGQRRRPAGRRRPLRARRVVELLDVGQRPARRHPGHQHSARRASGGPARRQRRGPARGGSGARTARRRHRPGRGRRGPRAVAPALRGSDDRPASGRGRRCPGPGDGGGALAGLHLALSRHHPEFSRPERDSGAQADAARPARRDGVAIAGPGRVRRPSAHASFALHLTIARPPVRHTGAQ
Molecular weight: 39.85 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
3,079 |
6 |
3,085 |
946,276 |
37 |
1,940 |
307.3 |
33.2 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
12.21 |
0.67 |
5.07 |
5.73 |
3.16 |
9.2 |
2.09 |
3.28 |
2.71 |
11.66 |
1.89 |
2.41 |
4.12 |
6.05 |
7.38 |
5.2 |
5.82 |
7.68 |
1.39 |
2.3 |
Note: For statistics only major isoforms were used (in this case 3,079 proteins)
For dipeptide frequency statistics click
here