Potato leafroll virus (strain Potato/Scotland/strain 1/1984) (PLrV)
Average proteome isoelectric point is 8.47
Get precalculated fractions of proteins
Acidic |
|
pI < 6.8 |
|
6.8-7.4 |
|
pI > 7.4 |
|
Basic |
|
All |
|
Virtual 2D-PAGE plot for 10 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|Q84829|Q84829_PLRV1 53K protein (Fragment)
VDSGSEPSPSPQPTPTPTPQKHERFIAYVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTKFSSEYYSQSSMQAVPMYYFNVPKGQWSVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADSDYWNVGEADGVKISKLRNDNTYRQGHPELEINSCHFREGQLLERDATISFHVEAPTDGRFFLV
GPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLEGTGSANRVRRPPREGHTYMASPHEPEGKPVGNKPRDETPIQTQERQPDQTPSDDVSDAGSVNSGGPTESLRLEFGVNSDSTYDATVDGTDWPRIPPPRHPPEPRVSGNSRTVTDFSSKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQD
GRSMLEKREENVKNKTSSWKPPSLKAVSPAIAKLRSIRKSQPLEGGTLNKDATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENFKKTNPPAATQWLFEYQPPPQVDRNIAEKPFQGRK
Molecular weight: 56.56 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>sp|P0C768|RAP1_PLRV1 Replication-associated protein
MTPMRITVWRERLQQMRPQRKLLKQTQQRRLLHQLQQRKLL
Molecular weight: 5.27 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
9 |
1 |
10 |
3,639 |
41 |
1,062 |
404.3 |
45.1 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
7.36 |
1.37 |
4.2 |
6.32 |
3.71 |
6.98 |
2.12 |
4.18 |
5.72 |
8.46 |
1.98 |
4.29 |
4.59 |
6.29 |
6.27 |
9.51 |
6.46 |
5.14 |
1.84 |
3.22 |
Note: For statistics only major isoforms were used (in this case 9 proteins)
For dipeptide frequency statistics click
here