Virtual 2D-PAGE plot for 5 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>sp|Q84709|P0_PEMVW Suppressor of silencing P0
MHGIEQPQLPLDYVHRCASTSFLLASLDGLLSEARELSGPLALITSSYYLLVSIALCWAIPGSFWYRPGCWLQPVSGRNLIFCGPTEALQRFRLYAARLGLVLSENCPRHGQSAAITLQSYWALPNNIWMDMAQLDLLTFSMPIANTFAYLADCEARFPPIVEGVGSAYYVPTLLGLTHQDPRLYLALRR RNLDLSGEPHRVRPGVLESMALLCSSVRSTSRSRQIPPLYGSVLHHVLGLAERDCILFDTDSNYSSYTHRVLEQDRNRADQSLFSIDLEYVHDLELIALGYSDEDDEDLDNFF
Molecular weight: 34.12 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>sp|P29153|CAPSD_PEMVW Major capsid protein
MPTRSRSKANQRRRRPRRVVVVAPSMAQPRTQSRRPRRRNKRGGGLNGSHTVDFSMVHGPFNGNATGTVKFGPSSDCQCIKGNLAAYQKYRIVWLKVVYQSEAAATDRGCIAYHVDTSTTKKAADVVLLDTWNIRSNGSATFGREILGDQPWYESNKDQFFFLYRGTGGTDVAGHYRISGRIQLMNASL
Molecular weight: 21.13 kDa Isoelectric point according different methods: