Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)
Average proteome isoelectric point is 6.33
Get precalculated fractions of proteins
Acidic |
 |
pI < 6.8 |
 |
6.8-7.4 |
 |
pI > 7.4 |
 |
Basic |
 |
All |
 |
Virtual 2D-PAGE plot for 5,973 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point
Protein with the lowest isoelectric point:>tr|G3AKZ0|G3AKZ0_SPAPN Putative uncharacterized protein (Fragment)
TVTVSNPDTTYVTTVTNPYYPPPTVTTIVNPDTTYVVTVTPPYVPPGVVTTITNPYTTYVTTGPYNPPVVVTTIVYPDTTLVATVTGPYVPPPLVTTVTGVNTVYVTTVYVTTVTYPTVYPPVPTGSQPGGTSPGNVTPDQEEELQVPPSGGNPNDPSNPNYPGGNPAPANPNYPGGNPAPANPNDPSAN
PEQEEELEVPYPGGNPSVPGNPNDSGNPNVPGNPNDSSNPNAPGNPNDSSNPNAPGNPNDSGNPNAPGNPNDPSLEQGGDEFVQDPNLFTYTSAVPTTFVSDGRTYASSVPVVYTTSVPQDGVPEVMVSPGNPAQGGYDDTLDANPPDLEELLEDFEGMATGLSYNTFMLCLCLISTTMFL
Molecular weight: 38.53 kDa
Isoelectric point according different methods:
Protein with the highest isoelectric point:>tr|G3AT84|G3AT84_SPAPN Putative uncharacterized protein
MPSQKSFRTKQKLAKAQKQNRPLPQWVRLRTGNTIRYNAKRRHWRRTKLGI
Molecular weight: 6.23 kDa
Isoelectric point according different methods:
General Statistics
Number of major isoforms |
Number of additional isoforms |
Number of all proteins |
Number of amino acids |
Min. Seq. Length |
Max. Seq. Length |
Avg. Seq. Length |
Avg. Mol. Weight |
5,972 |
1 |
5,973 |
2,692,878 |
49 |
4,210 |
450.9 |
50.9 kDa |
Amino acid frequency
Ala |
Cys |
Asp |
Glu |
Phe |
Gly |
His |
Ile |
Lys |
Leu |
Met |
Asn |
Gln |
Pro |
Arg |
Ser |
Thr |
Val |
Trp |
Tyr |
5.58 |
1.11 |
5.9 |
6.76 |
4.45 |
5.22 |
2.21 |
6.93 |
6.96 |
9.35 |
1.9 |
5.6 |
4.27 |
4.68 |
4.11 |
8.43 |
5.96 |
5.93 |
1.03 |
3.62 |
Note: For statistics only major isoforms were used (in this case 5,972 proteins)
For dipeptide frequency statistics click
here