Virtual 2D-PAGE plot for 7,656 proteins (isoelectric point calculated using IPC_method)
Get csv file with sequences according given criteria:
* You can choose from 18 different methods for calculating isoelectric point Protein with the lowest isoelectric point:
>tr|U5HF90|U5HF90_USTV1 Uncharacterized protein
MTALVPPPSMDLFPTDDFYPTTSTNLYDDSEDSALDVPLHPRGGGQTELAEADEEEDDEEDGDEGGAEEEELGDDDTDEEEDAEEADEQQHDDVAGEQGGDDDDEDEDDDGDEDDEQGEGGEDDDEGEEDNDEDEGGEDEPARKRQRREPEDEEGDDDDDDEDSDEERPNFQGPPQEGYNDENENDEEDD LEDEEDEE
Molecular weight: 22.11 kDa Isoelectric point according different methods:
Protein with the highest isoelectric point:
>tr|U5HDW4|U5HDW4_USTV1 Uncharacterized protein
MASLLRNVFSLTSRTRFTSARSSPSSSTIPTVWRSPSTSSISSSTPSAASSSLLSRPFSSTPLSRGLVRKPTKIKLKTHKGAAKRWFAIANGNFKRSQAGKVHLNGVLSPTRLNRLGKPAFARPIEKKKLRRLMPYA
Molecular weight: 14.97 kDa Isoelectric point according different methods: